Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries) |
Domain d2xh4c2: 2xh4 C:141-438 [207244] Other proteins in same PDB: d2xh4a1, d2xh4b1, d2xh4c1, d2xh4d1 automated match to d1pdza1 complexed with 2pg, mg; mutant |
PDB Entry: 2xh4 (more details), 1.7 Å
SCOPe Domain Sequences for d2xh4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xh4c2 c.1.11.0 (C:141-438) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh
Timeline for d2xh4c2: