Lineage for d2xh4c2 (2xh4 C:141-438)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344130Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries)
  8. 1344145Domain d2xh4c2: 2xh4 C:141-438 [207244]
    Other proteins in same PDB: d2xh4a1, d2xh4b1, d2xh4c1, d2xh4d1
    automated match to d1pdza1
    complexed with 2pg, mg; mutant

Details for d2xh4c2

PDB Entry: 2xh4 (more details), 1.7 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1
PDB Compounds: (C:) enolase 1

SCOPe Domain Sequences for d2xh4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xh4c2 c.1.11.0 (C:141-438) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh

SCOPe Domain Coordinates for d2xh4c2:

Click to download the PDB-style file with coordinates for d2xh4c2.
(The format of our PDB-style files is described here.)

Timeline for d2xh4c2: