SCOPe 2.03: Domain d2xh4a1: 2xh4 A:1-140

Lineage for d2xh4a1 (2xh4 A:1-140)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)

8. Domain d2xh4a1: 2xh4 A:1-140 [207239]
   Other proteins in same PDB: d2xh4a2, d2xh4b2, d2xh4c2, d2xh4d2
   automated match to d1pdza2
   complexed with 2pg, mg; mutant

Details for d2xh4a1

PDB Entry: 2xh4, 1.7 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1

PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d2xh4a1:

Sequence; same for both SEQRES and ATOM records:

>d2xh4a1 d.54.1.0 (A:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

Timeline for d2xh4a1:

• d2xh4a1 is new in SCOPe 2.03-stable
  
• d2xh4a1 appears in SCOPe 2.04
  
• d2xh4a1 appears in the current release, SCOPe 2.08