Lineage for d2xgzb1 (2xgz B:1-140)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905301Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)
  8. 1905311Domain d2xgzb1: 2xgz B:1-140 [207221]
    Other proteins in same PDB: d2xgza2, d2xgzb2
    automated match to d1pdza2
    complexed with mg, pep; mutant

Details for d2xgzb1

PDB Entry: 2xgz (more details), 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39n d321r mutant of yeast enolase 1
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d2xgzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgzb1 d.54.1.0 (B:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgantgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

SCOPe Domain Coordinates for d2xgzb1:

Click to download the PDB-style file with coordinates for d2xgzb1.
(The format of our PDB-style files is described here.)

Timeline for d2xgzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xgzb2