SCOPe 2.08: Domain d2xfpb1: 2xfp B:3-289,B:402-496

Lineage for d2xfpb1 (2xfp B:3-289,B:402-496)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Monoamine oxidase B [69423] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69424] (46 PDB entries)

8. Domain d2xfpb1: 2xfp B:3-289,B:402-496 [207200]
   Other proteins in same PDB: d2xfpa2, d2xfpb2
   automated match to d1s3ea1
   complexed with c15, fad, isn, xcg

Details for d2xfpb1

PDB Entry: 2xfp, 1.66 Å

PDB Description: isatin-inhibited human monoamine oxidase b in complex with 2-(2- benzofuranyl)-2-imidazoline

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2xfpb1:

Sequence; same for both SEQRES and ATOM records:

>d2xfpb1 c.3.1.2 (B:3-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrli

Timeline for d2xfpb1:

• d2xfpb1 first appeared in SCOPe 2.03
  
• d2xfpb1 appears in SCOPe 2.07