SCOP 1.57: Domain d1b0ra1: 1b0r A:182-275

Lineage for d1b0ra1 (1b0r A:182-275)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (24 PDB entries)

8. Domain d1b0ra1: 1b0r A:182-275 [20720]
   Other proteins in same PDB: d1b0ra2

Details for d1b0ra1

PDB Entry: 1b0r, 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group

SCOP Domain Sequences for d1b0ra1:

Sequence, based on SEQRES records:

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrqdtelvetrpagdgtfqkwaav
vvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1b0ra1:

• d1b0ra1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0ra1 appears in SCOP 1.59
  
• d1b0ra1 appears in the current release, SCOPe 2.08