Lineage for d1qr1d1 (1qr1 D:182-275)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932657Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 932804Domain d1qr1d1: 1qr1 D:182-275 [20714]
    Other proteins in same PDB: d1qr1a2, d1qr1b_, d1qr1d2, d1qr1e_

Details for d1qr1d1

PDB Entry: 1qr1 (more details), 2.4 Å

PDB Description: poor binding of a her-2/neu epitope (gp2) to hla-a2.1 is due to a lack of interactions in the center of the peptide
PDB Compounds: (D:) hla-a2.1 heavy chain

SCOPe Domain Sequences for d1qr1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr1d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1qr1d1:

Click to download the PDB-style file with coordinates for d1qr1d1.
(The format of our PDB-style files is described here.)

Timeline for d1qr1d1: