SCOPe 2.05: Domain d2x77a_: 2x77 A:

Lineage for d2x77a_ (2x77 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [225849] (1 PDB entry)

8. Domain d2x77a_: 2x77 A: [207137]
   automated match to d1e0sa_
   complexed with gdp, mg

Details for d2x77a_

PDB Entry: 2x77, 2.1 Å

PDB Description: crystal structure of leishmania major adp ribosylation factor-like 1.

PDB Compounds: (A:) ADP-ribosylation factor

SCOPe Domain Sequences for d2x77a_:

Sequence; same for both SEQRES and ATOM records:

>d2x77a_ c.37.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
wlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnletlqykn
isfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrksl
llifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq
g

Timeline for d2x77a_:

• d2x77a_ first appeared in SCOPe 2.03
  
• d2x77a_ appears in SCOPe 2.04
  
• d2x77a_ appears in SCOPe 2.06
  
• d2x77a_ appears in the current release, SCOPe 2.08