SCOPe 2.03: Domain d2x5dd_: 2x5d D:

Lineage for d2x5dd_ (2x5d D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [225932] (1 PDB entry)

8. Domain d2x5dd_: 2x5d D: [207134]
   automated match to d3jtxb_
   complexed with plp, so4

Details for d2x5dd_

PDB Entry: 2x5d, 2.25 Å

PDB Description: crystal structure of a probable aminotransferase from pseudomonas aeruginosa

PDB Compounds: (D:) probable aminotransferase

SCOPe Domain Sequences for d2x5dd_:

Sequence; same for both SEQRES and ATOM records:

>d2x5dd_ c.67.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvaqredthgystsrgiprl
rraishwyrdrydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiyga
viagaqvrsvplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervval
akqydvmvvhdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgn
pelvsalariksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagw
mvenpkasmyvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalien
rdrlrqavrgikamfradgl

Timeline for d2x5dd_:

• d2x5dd_ is new in SCOPe 2.03-stable
  
• d2x5dd_ appears in SCOPe 2.04
  
• d2x5dd_ appears in the current release, SCOPe 2.08