Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (4 PDB entries) |
Domain d2x1fa_: 2x1f A: [207100] automated match to d1x5ta1 protein/RNA complex |
PDB Entry: 2x1f (more details), 1.6 Å
SCOPe Domain Sequences for d2x1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1fa_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} psrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessasa vrnlngyqlgsrflkcgyssnsdisgvslehhhh
Timeline for d2x1fa_: