Lineage for d2x1fa_ (2x1f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416109Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1416110Protein automated matches [190896] (3 species)
    not a true protein
  7. 1416111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (4 PDB entries)
  8. 1416114Domain d2x1fa_: 2x1f A: [207100]
    automated match to d1x5ta1
    protein/RNA complex

Details for d2x1fa_

PDB Entry: 2x1f (more details), 1.6 Å

PDB Description: structure of rna15 rrm with bound rna (gu)
PDB Compounds: (A:) mRNA 3'-end-processing protein rna15

SCOPe Domain Sequences for d2x1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1fa_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessasa
vrnlngyqlgsrflkcgyssnsdisgvslehhhh

SCOPe Domain Coordinates for d2x1fa_:

Click to download the PDB-style file with coordinates for d2x1fa_.
(The format of our PDB-style files is described here.)

Timeline for d2x1fa_: