SCOPe 2.08: Domain d2x1fa1: 2x1f A:16-103

Lineage for d2x1fa1 (2x1f A:16-103)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)

8. Domain d2x1fa1: 2x1f A:16-103 [207100]
   Other proteins in same PDB: d2x1fa2
   automated match to d1x5ta1
   protein/RNA complex

Details for d2x1fa1

PDB Entry: 2x1f, 1.6 Å

PDB Description: structure of rna15 rrm with bound rna (gu)

PDB Compounds: (A:) mRNA 3'-end-processing protein rna15

SCOPe Domain Sequences for d2x1fa1:

Sequence; same for both SEQRES and ATOM records:

>d2x1fa1 d.58.7.0 (A:16-103) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessasa
vrnlngyqlgsrflkcgyssnsdisgvs

Timeline for d2x1fa1:

• d2x1fa1 first appeared in SCOPe 2.03, called d2x1fa_
  
• d2x1fa1 appears in SCOPe 2.07