SCOPe 2.03: Domain d1hhid1: 1hhi D:182-275

Lineage for d1hhid1 (1hhi D:182-275)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (186 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d1hhid1: 1hhi D:182-275 [20710]
   Other proteins in same PDB: d1hhia2, d1hhib_, d1hhid2, d1hhie_

Details for d1hhid1

PDB Entry: 1hhi, 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

PDB Compounds: (D:) class I histocompatibility antigen (hla-a*0201) (alpha chain)

SCOPe Domain Sequences for d1hhid1:

Sequence; same for both SEQRES and ATOM records:

>d1hhid1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1hhid1:

• d1hhid1 first appeared (with stable ids) in SCOP 1.55
  
• d1hhid1 appears in SCOPe 2.02
  
• d1hhid1 appears in SCOPe 2.04
  
• d1hhid1 appears in the current release, SCOPe 2.08