Class a: All alpha proteins [46456] (289 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) |
Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species) |
Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries) Uniprot Q8XL08 496-624 |
Domain d2x0ya3: 2x0y A:496-624 [207093] Other proteins in same PDB: d2x0ya1, d2x0ya2, d2x0yb1, d2x0yb2 automated match to d2cbia1 complexed with x0t |
PDB Entry: 2x0y (more details), 2.25 Å
SCOPe Domain Sequences for d2x0ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0ya3 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]} edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe alsfdltli
Timeline for d2x0ya3: