SCOPe 2.03: Domain d2x0ya3: 2x0y A:496-624

Lineage for d2x0ya3 (2x0y A:496-624)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
   Uniprot Q8XL08 496-624

8. Domain d2x0ya3: 2x0y A:496-624 [207093]
   Other proteins in same PDB: d2x0ya1, d2x0ya2, d2x0yb1, d2x0yb2
   automated match to d2cbia1
   complexed with x0t

Details for d2x0ya3

PDB Entry: 2x0y, 2.25 Å

PDB Description: screening-based discovery of drug-like o-glcnacase inhibitor scaffolds

PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2x0ya3:

Sequence; same for both SEQRES and ATOM records:

>d2x0ya3 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2x0ya3:

• d2x0ya3 is new in SCOPe 2.03-stable
  
• d2x0ya3 appears in SCOPe 2.04
  
• d2x0ya3 appears in the current release, SCOPe 2.08