Lineage for d2x0ya3 (2x0y A:496-624)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286610Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 1286611Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) (S)
  5. 1286612Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 1286630Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)
  7. 1286631Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
    Uniprot Q8XL08 496-624
  8. 1286638Domain d2x0ya3: 2x0y A:496-624 [207093]
    Other proteins in same PDB: d2x0ya1, d2x0ya2, d2x0yb1, d2x0yb2
    automated match to d2cbia1
    complexed with x0t

Details for d2x0ya3

PDB Entry: 2x0y (more details), 2.25 Å

PDB Description: screening-based discovery of drug-like o-glcnacase inhibitor scaffolds
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2x0ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x0ya3 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d2x0ya3:

Click to download the PDB-style file with coordinates for d2x0ya3.
(The format of our PDB-style files is described here.)

Timeline for d2x0ya3: