![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (20 PDB entries) |
![]() | Domain d1hhjd1: 1hhj D:182-275 [20706] Other proteins in same PDB: d1hhja2, d1hhjd2 |
PDB Entry: 1hhj (more details), 2.5 Å
SCOP Domain Sequences for d1hhjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhjd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1hhjd1:
![]() Domains from other chains: (mouse over for more information) d1hhja1, d1hhja2, d1hhjb1, d1hhje1 |