Lineage for d2wwic_ (2wwi C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598422Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)
  8. 1598442Domain d2wwic_: 2wwi C: [207052]
    automated match to d3tmke_
    complexed with adp, atm

Details for d2wwic_

PDB Entry: 2wwi (more details), 2.99 Å

PDB Description: plasmodium falciparum thymidylate kinase in complex with aztmp and adp
PDB Compounds: (C:) thymidilate kinase, putative

SCOPe Domain Sequences for d2wwic_:

Sequence, based on SEQRES records: (download)

>d2wwic_ c.37.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatr
kiedihndivkevtkikvepeefnflws

Sequence, based on observed residues (ATOM records): (download)

>d2wwic_ c.37.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrdygeeiyekvetqkkiyetykhfahedywinidatrk
iedihndivkevtkvepeefnflws

SCOPe Domain Coordinates for d2wwic_:

Click to download the PDB-style file with coordinates for d2wwic_.
(The format of our PDB-style files is described here.)

Timeline for d2wwic_: