SCOPe 2.04: Domain d2wwia_: 2wwi A:

Lineage for d2wwia_ (2wwi A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)

8. Domain d2wwia_: 2wwi A: [207050]
   automated match to d3tmke_
   complexed with adp, atm

Details for d2wwia_

PDB Entry: 2wwi, 2.99 Å

PDB Description: plasmodium falciparum thymidylate kinase in complex with aztmp and adp

PDB Compounds: (A:) thymidilate kinase, putative

SCOPe Domain Sequences for d2wwia_:

Sequence; same for both SEQRES and ATOM records:

>d2wwia_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatr
kiedihndivkevtkikvepeefnflws

Timeline for d2wwia_:

• d2wwia_ first appeared in SCOPe 2.03
  
• d2wwia_ appears in SCOPe 2.05
  
• d2wwia_ appears in the current release, SCOPe 2.08