Lineage for d2wuab1 (2wua B:45-309)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1392970Species Helianthus annuus [TaxId:4232] [225892] (1 PDB entry)
  8. 1392973Domain d2wuab1: 2wua B:45-309 [207024]
    automated match to d1afwa1

Details for d2wuab1

PDB Entry: 2wua (more details), 1.8 Å

PDB Description: structure of the peroxisomal 3-ketoacyl-coa thiolase from sunflower
PDB Compounds: (B:) acetoacetyl coa thiolase

SCOPe Domain Sequences for d2wuab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wuab1 c.95.1.0 (B:45-309) automated matches {Helianthus annuus [TaxId: 4232]}
vfgddvvivaayrsplckakrgglkdtypddilapvlkaliektninpaevgdivvgsvl
gagsqrasecrmaafyagfpetvpvrtvnrqcssglqavadvaaaikagfydigigagle
smtanpmawegsvnpkvktmaqaqdcllpmgitsenvaqkfsitrqeqdqaavgshrkta
aataagrfkdeiipiktkivdpktgdekpvtisvddgirpgtsladlaklkpvfrkdgst
tagtssqvsdgagavllmkrsialq

SCOPe Domain Coordinates for d2wuab1:

Click to download the PDB-style file with coordinates for d2wuab1.
(The format of our PDB-style files is described here.)

Timeline for d2wuab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wuab2