Lineage for d2wtra1 (2wtr A:4-175)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770834Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 1770835Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 1770836Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries)
  8. 1770845Domain d2wtra1: 2wtr A:4-175 [207012]
    Other proteins in same PDB: d2wtrb1, d2wtrb2
    automated match to d1jsya1
    complexed with ba

Details for d2wtra1

PDB Entry: 2wtr (more details), 2.9 Å

PDB Description: full length arrestin2
PDB Compounds: (A:) beta-arrestin-1

SCOPe Domain Sequences for d2wtra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtra1 b.1.18.11 (A:4-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
kgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafry
gredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnl
pcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOPe Domain Coordinates for d2wtra1:

Click to download the PDB-style file with coordinates for d2wtra1.
(The format of our PDB-style files is described here.)

Timeline for d2wtra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wtra2