Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries) |
Domain d2wrti1: 2wrt I:2-80 [207000] Other proteins in same PDB: d2wrta2, d2wrtb2, d2wrtc2, d2wrtd2, d2wrte2, d2wrtf2, d2wrtg2, d2wrth2, d2wrti2, d2wrtj2, d2wrtk2, d2wrtl2 automated match to d1m9aa2 complexed with cl |
PDB Entry: 2wrt (more details), 2.4 Å
SCOPe Domain Sequences for d2wrti1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrti1 c.47.1.0 (I:2-80) automated matches {Fasciola hepatica [TaxId: 6192]} paklgywkirglqqpvrllleylgeeyeehlygrddrekwlgdkfnmgldlpnlpyyidd kckltqsvaimryiadkhg
Timeline for d2wrti1: