Lineage for d1qrna1 (1qrn A:182-274)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548583Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries)
  8. 548667Domain d1qrna1: 1qrn A:182-274 [20698]
    Other proteins in same PDB: d1qrna2, d1qrnb_, d1qrnd1, d1qrnd2, d1qrne1, d1qrne2

Details for d1qrna1

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a
PDB Compounds: (A:)

SCOP Domain Sequences for d1qrna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrna1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOP Domain Coordinates for d1qrna1:

Click to download the PDB-style file with coordinates for d1qrna1.
(The format of our PDB-style files is described here.)

Timeline for d1qrna1: