Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
Protein automated matches [226952] (2 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [225326] (6 PDB entries) |
Domain d2wqxb1: 2wqx B:36-240 [206966] Other proteins in same PDB: d2wqxa2, d2wqxb2 automated match to d1m9sa5 mutant |
PDB Entry: 2wqx (more details), 2.03 Å
SCOPe Domain Sequences for d2wqxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqxb1 c.10.2.1 (B:36-240) automated matches {Listeria monocytogenes [TaxId: 169963]} etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis dinglvhlpqleslylgnnkitditvlsrltkldtlslednqirrivplarltklqnlyl sknhisdlralrglknldvlelfsq
Timeline for d2wqxb1: