SCOPe 2.08: Domain d2wqxb1: 2wqx B:36-240

Lineage for d2wqxb1 (2wqx B:36-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein automated matches [226952] (2 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [225326] (6 PDB entries)

8. Domain d2wqxb1: 2wqx B:36-240 [206966]
   Other proteins in same PDB: d2wqxa2, d2wqxb2
   automated match to d1m9sa5
   mutant

Details for d2wqxb1

PDB Entry: 2wqx, 2.03 Å

PDB Description: inlb321_4r: s199r, d200r, g206r, a227r, c242a mutant of the listeria monocytogenes inlb internalin domain

PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d2wqxb1:

Sequence; same for both SEQRES and ATOM records:

>d2wqxb1 c.10.2.1 (B:36-240) automated matches {Listeria monocytogenes [TaxId: 169963]}
etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqirrivplarltklqnlyl
sknhisdlralrglknldvlelfsq

Timeline for d2wqxb1:

• d2wqxb1 first appeared in SCOPe 2.03
  
• d2wqxb1 appears in SCOPe 2.07