Lineage for d1ao7a1 (1ao7 A:182-274)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220434Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)
  8. 220523Domain d1ao7a1: 1ao7 A:182-274 [20696]
    Other proteins in same PDB: d1ao7a2, d1ao7d_, d1ao7e1, d1ao7e2
    complexed with emc; mutant

Details for d1ao7a1

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao7a1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOP Domain Coordinates for d1ao7a1:

Click to download the PDB-style file with coordinates for d1ao7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ao7a1: