Lineage for d2wp3t_ (2wp3 T:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754305Domain d2wp3t_: 2wp3 T: [206943]
    automated match to d2y9rt_
    complexed with gol, so4

Details for d2wp3t_

PDB Entry: 2wp3 (more details), 1.48 Å

PDB Description: crystal structure of the titin m10-obscurin like 1 ig complex
PDB Compounds: (T:) titin

SCOPe Domain Sequences for d2wp3t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wp3t_ b.1.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirsi

SCOPe Domain Coordinates for d2wp3t_:

Click to download the PDB-style file with coordinates for d2wp3t_.
(The format of our PDB-style files is described here.)

Timeline for d2wp3t_: