Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
Domain d2wohb2: 2woh B:91-185 [206936] Other proteins in same PDB: d2woha1, d2woha4, d2wohb1, d2wohb4 automated match to d1oacb2 complexed with ca, cu, sr |
PDB Entry: 2woh (more details), 2.7 Å
SCOPe Domain Sequences for d2wohb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wohb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr kadvimldgkhiieavvdlqnnkllswqpikdahg
Timeline for d2wohb2:
View in 3D Domains from other chains: (mouse over for more information) d2woha1, d2woha2, d2woha3, d2woha4 |