SCOPe 2.03: Domain d2wnrf1: 2wnr F:14-153

Lineage for d2wnrf1 (2wnr F:14-153)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (13 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [225885] (1 PDB entry)

8. Domain d2wnrf1: 2wnr F:14-153 [206908]
   Other proteins in same PDB: d2wnra2, d2wnrb2, d2wnrc2, d2wnrd2, d2wnre2, d2wnrf2
   automated match to d2nn6b1
   complexed with po4

Details for d2wnrf1

PDB Entry: 2wnr, 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly

PDB Compounds: (F:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2wnrf1:

Sequence, based on SEQRES records:

>d2wnrf1 d.14.1.0 (F:14-153) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
psvredgrafdelrplkieagileradgssylefggnkilvavygpreaqirklqrpdra
vircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleae
ggtrcagitaasvaladagi

Sequence, based on observed residues (ATOM records):

>d2wnrf1 d.14.1.0 (F:14-153) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
psvredgrafdelrplkieagileradgssylefggnkilvavygpreapdravircryn
mapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeggtrcag
itaasvaladagi

Timeline for d2wnrf1:

• d2wnrf1 is new in SCOPe 2.03-stable
  
• d2wnrf1 appears in SCOPe 2.04
  
• d2wnrf1 appears in the current release, SCOPe 2.08