Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (13 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [225885] (1 PDB entry) |
Domain d2wnrf1: 2wnr F:14-153 [206908] Other proteins in same PDB: d2wnra2, d2wnrb2, d2wnrc2, d2wnrd2, d2wnre2, d2wnrf2 automated match to d2nn6b1 complexed with po4 |
PDB Entry: 2wnr (more details), 2.65 Å
SCOPe Domain Sequences for d2wnrf1:
Sequence, based on SEQRES records: (download)
>d2wnrf1 d.14.1.0 (F:14-153) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} psvredgrafdelrplkieagileradgssylefggnkilvavygpreaqirklqrpdra vircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleae ggtrcagitaasvaladagi
>d2wnrf1 d.14.1.0 (F:14-153) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} psvredgrafdelrplkieagileradgssylefggnkilvavygpreapdravircryn mapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeggtrcag itaasvaladagi
Timeline for d2wnrf1: