SCOPe 2.08: Domain d2wnrb1: 2wnr B:15-153

Lineage for d2wnrb1 (2wnr B:15-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [225885] (1 PDB entry)

8. Domain d2wnrb1: 2wnr B:15-153 [206904]
   Other proteins in same PDB: d2wnra2, d2wnrb2, d2wnrc2, d2wnrd2, d2wnre2, d2wnrf2
   automated match to d2nn6b1
   complexed with po4

Details for d2wnrb1

PDB Entry: 2wnr, 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly

PDB Compounds: (B:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2wnrb1:

Sequence; same for both SEQRES and ATOM records:

>d2wnrb1 d.14.1.0 (B:15-153) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
svredgrafdelrplkieagileradgssylefggnkilvavygpreaqirklqrpdrav
ircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeg
gtrcagitaasvaladagi

Timeline for d2wnrb1:

• d2wnrb1 first appeared in SCOPe 2.03
  
• d2wnrb1 appears in SCOPe 2.07