SCOP 1.55: Domain d1hhka1: 1hhk A:182-275

Lineage for d1hhka1 (1hhk A:182-275)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (20 PDB entries)

8. Domain d1hhka1: 1hhk A:182-275 [20690]
   Other proteins in same PDB: d1hhka2, d1hhkd2

Details for d1hhka1

PDB Entry: 1hhk, 2.5 Å

PDB Description: the antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation of five peptides presented by hla-a2

SCOP Domain Sequences for d1hhka1:

Sequence, based on SEQRES records:

>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpl

Sequence, based on observed residues (ATOM records):

>d1hhka1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1hhka1:

• d1hhka1 appears in SCOP 1.57
  
• d1hhka1 appears in the current release, SCOPe 2.08