SCOPe 2.04: Domain d2wjib_: 2wji B:

Lineage for d2wjib_ (2wji B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (5 PDB entries)

8. Domain d2wjib_: 2wji B: [206853]
   automated match to d2cxxa1
   complexed with gnp, mg, po4

Details for d2wjib_

PDB Entry: 2wji, 1.9 Å

PDB Description: structure and function of the feob g-domain from methanococcus jannaschii

PDB Compounds: (B:) ferrous iron transport protein b homolog

SCOPe Domain Sequences for d2wjib_:

Sequence, based on SEQRES records:

>d2wjib_ c.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkd

Sequence, based on observed residues (ATOM records):

>d2wjib_ c.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mksyeialignpnvgkstifnaltgenvvekkegefeyngekfkvvdlpgvysltansid
eiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdlakslgieid
vdklekilgvkvvplsaakkmgieelkkaisiavkd

Timeline for d2wjib_:

• d2wjib_ first appeared in SCOPe 2.03
  
• d2wjib_ appears in SCOPe 2.05
  
• d2wjib_ appears in the current release, SCOPe 2.08