SCOPe 2.03: Domain d2wjhb_: 2wjh B:

Lineage for d2wjhb_ (2wjh B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [225748] (4 PDB entries)

8. Domain d2wjhb_: 2wjh B: [206851]
   automated match to d2cxxa1
   complexed with flc, gdp, mg

Details for d2wjhb_

PDB Entry: 2wjh, 2.1 Å

PDB Description: structure and function of the feob g-domain from methanococcus jannaschii

PDB Compounds: (B:) ferrous iron transport protein b homolog

SCOPe Domain Sequences for d2wjhb_:

Sequence; same for both SEQRES and ATOM records:

>d2wjhb_ c.37.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl

Timeline for d2wjhb_:

• d2wjhb_ is new in SCOPe 2.03-stable
  
• d2wjhb_ appears in SCOPe 2.04
  
• d2wjhb_ appears in the current release, SCOPe 2.08