SCOP 1.67: Domain d1i1yd1: 1i1y D:182-275

Lineage for d1i1yd1 (1i1y D:182-275)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)

8. Domain d1i1yd1: 1i1y D:182-275 [20684]
   Other proteins in same PDB: d1i1ya2, d1i1yb_, d1i1yd2, d1i1ye_

Details for d1i1yd1

PDB Entry: 1i1y, 2.2 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

SCOP Domain Sequences for d1i1yd1:

Sequence; same for both SEQRES and ATOM records:

>d1i1yd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1i1yd1:

• d1i1yd1 first appeared (with stable ids) in SCOP 1.55
  
• d1i1yd1 appears in SCOP 1.65
  
• d1i1yd1 appears in SCOP 1.69
  
• d1i1yd1 appears in the current release, SCOPe 2.08