Lineage for d1i1yd1 (1i1y D:182-275)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 52936Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (24 PDB entries)
  8. 52965Domain d1i1yd1: 1i1y D:182-275 [20684]
    Other proteins in same PDB: d1i1ya2, d1i1yd2

Details for d1i1yd1

PDB Entry: 1i1y (more details), 2.2 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

SCOP Domain Sequences for d1i1yd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1yd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1i1yd1:

Click to download the PDB-style file with coordinates for d1i1yd1.
(The format of our PDB-style files is described here.)

Timeline for d1i1yd1: