Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries) |
Domain d2whtc_: 2wht C: [206832] automated match to d3neda_ |
PDB Entry: 2wht (more details), 1.9 Å
SCOPe Domain Sequences for d2whtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2whtc_ d.22.1.1 (C:) automated matches {Montipora sp. [TaxId: 321802]} sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk pvrmpgrheidrkldvtshnrdytsveqceiaiarhsl
Timeline for d2whtc_: