Lineage for d1i1ya1 (1i1y A:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358144Species Human (Homo sapiens) [TaxId:9606] [88605] (201 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2358300Domain d1i1ya1: 1i1y A:182-275 [20682]
    Other proteins in same PDB: d1i1ya2, d1i1yb2, d1i1yb3, d1i1yd2, d1i1ye2, d1i1ye3

Details for d1i1ya1

PDB Entry: 1i1y (more details), 2.2 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y
PDB Compounds: (A:) class I histocompatibility antigen

SCOPe Domain Sequences for d1i1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ya1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1i1ya1:

Click to download the PDB-style file with coordinates for d1i1ya1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ya1: