Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (4 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries) |
Domain d2whib1: 2whi B:3-104 [206814] Other proteins in same PDB: d2whia2, d2whib2, d2whic2, d2whid2, d2whie2, d2whif2 automated match to d1f52a1 complexed with 1az, 1pe, cl, mg, p3s, po4 |
PDB Entry: 2whi (more details), 2.2 Å
SCOPe Domain Sequences for d2whib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2whib1 d.15.9.0 (B:3-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfq sihesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d2whib1: