Lineage for d2whia2 (2whi A:105-478)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668438Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1668439Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1668689Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 1668690Protein automated matches [227028] (5 species)
    not a true protein
  7. 1668744Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)
  8. 1668763Domain d2whia2: 2whi A:105-478 [206813]
    Other proteins in same PDB: d2whia1, d2whib1, d2whic1, d2whid1, d2whie1, d2whif1
    automated match to d1f52a2
    complexed with 1az, 1pe, cl, mg, p3s, po4

Details for d2whia2

PDB Entry: 2whi (more details), 2.2 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate.
PDB Compounds: (A:) glutamine synthetase 1

SCOPe Domain Sequences for d2whia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whia2 d.128.1.0 (A:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d2whia2:

Click to download the PDB-style file with coordinates for d2whia2.
(The format of our PDB-style files is described here.)

Timeline for d2whia2: