Lineage for d2wgsa1 (2wgs A:4-104)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639568Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 1639693Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 1639694Protein automated matches [226862] (3 species)
    not a true protein
  7. 1639744Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 1639775Domain d2wgsa1: 2wgs A:4-104 [206786]
    Other proteins in same PDB: d2wgsa2, d2wgsb2, d2wgsc2, d2wgsd2, d2wgse2, d2wgsf2, d2wgsg2, d2wgsh2, d2wgsi2, d2wgsj2, d2wgsk2, d2wgsl2
    automated match to d1f52a1
    complexed with 1az, cl

Details for d2wgsa1

PDB Entry: 2wgs (more details), 2.55 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
PDB Compounds: (A:) glutamine synthetase 1

SCOPe Domain Sequences for d2wgsa1:

Sequence, based on SEQRES records: (download)

>d2wgsa1 d.15.9.0 (A:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

Sequence, based on observed residues (ATOM records): (download)

>d2wgsa1 d.15.9.0 (A:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
dmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d2wgsa1:

Click to download the PDB-style file with coordinates for d2wgsa1.
(The format of our PDB-style files is described here.)

Timeline for d2wgsa1: