Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries) |
Domain d2wdub1: 2wdu B:2-84 [206775] Other proteins in same PDB: d2wdua2, d2wdub2 automated match to d2f8fa2 complexed with br, dms, gds, gsh |
PDB Entry: 2wdu (more details), 1.62 Å
SCOPe Domain Sequences for d2wdub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdub1 c.47.1.0 (B:2-84) automated matches {Fasciola hepatica [TaxId: 6192]} dkqhfklwyfqfrgraepirllltcagvkfedyqftmdqwptikptlpggrvplldvtgp dgklrryqesmaiarllarqfkm
Timeline for d2wdub1: