Lineage for d2wcaa2 (2wca A:127-436)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095124Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2095145Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)
  7. 2095146Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries)
    Uniprot Q89ZI2 148-457
  8. 2095155Domain d2wcaa2: 2wca A:127-436 [206764]
    Other proteins in same PDB: d2wcaa1, d2wcaa3
    automated match to d2j47a2
    complexed with ca, np6

Details for d2wcaa2

PDB Entry: 2wca (more details), 2.3 Å

PDB Description: btgh84 in complex with n-butyl pugnac
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcaa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d2wcaa2:

Click to download the PDB-style file with coordinates for d2wcaa2.
(The format of our PDB-style files is described here.)

Timeline for d2wcaa2: