Lineage for d2wcaa1 (2wca A:5-126)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1424519Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1424588Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 1424589Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 1424590Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (10 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 1424602Domain d2wcaa1: 2wca A:5-126 [206763]
    Other proteins in same PDB: d2wcaa2, d2wcaa3
    automated match to d2j47a3
    complexed with ca, np6

Details for d2wcaa1

PDB Entry: 2wca (more details), 2.3 Å

PDB Description: btgh84 in complex with n-butyl pugnac
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wcaa1:

Sequence, based on SEQRES records: (download)

>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records): (download)

>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d2wcaa1:

Click to download the PDB-style file with coordinates for d2wcaa1.
(The format of our PDB-style files is described here.)

Timeline for d2wcaa1: