SCOPe 2.03: Domain d2wbia2: 2wbi A:266-425

Lineage for d2wbia2 (2wbi A:266-425)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225243] (3 PDB entries)

8. Domain d2wbia2: 2wbi A:266-425 [206760]
   Other proteins in same PDB: d2wbia1, d2wbib1
   automated match to d1ukwa1
   complexed with fad, po4, unx

Details for d2wbia2

PDB Entry: 2wbi, 2.8 Å

PDB Description: crystal structure of human acyl-coa dehydrogenase 11

PDB Compounds: (A:) acyl-coa dehydrogenase family member 11

SCOPe Domain Sequences for d2wbia2:

Sequence; same for both SEQRES and ATOM records:

>d2wbia2 a.29.3.0 (A:266-425) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgfeisqgrlgpgrihhcmrtvglaeralqimceratqriafkkklyahevvahwiaes
riaiekirlltlkaahsmdtlgsagakkeiamikvaapravskivdwaiqvcggagvsqd
yplanmyaitrvlrladgpdevhlsaiatmelrdqakrlt

Timeline for d2wbia2:

• d2wbia2 is new in SCOPe 2.03-stable
  
• d2wbia2 appears in SCOPe 2.04
  
• d2wbia2 appears in the current release, SCOPe 2.08