Lineage for d2wbia1 (2wbi A:22-265)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570656Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries)
  8. 2570661Domain d2wbia1: 2wbi A:22-265 [206759]
    Other proteins in same PDB: d2wbia2, d2wbib2
    automated match to d1ukwa2
    complexed with fad, po4, unx

Details for d2wbia1

PDB Entry: 2wbi (more details), 2.8 Å

PDB Description: crystal structure of human acyl-coa dehydrogenase 11
PDB Compounds: (A:) acyl-coa dehydrogenase family member 11

SCOPe Domain Sequences for d2wbia1:

Sequence, based on SEQRES records: (download)

>d2wbia1 e.6.1.0 (A:22-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtrkgqevlikvkhfmkqhilpaekevtefyvqnensvdkwgkplvidklkemakvegl
wnlflpavsglshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwle
pllqgnitscfcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivl
grtqntslsrhkqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnl
ilge

Sequence, based on observed residues (ATOM records): (download)

>d2wbia1 e.6.1.0 (A:22-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtrkgqevlikvkhfmkqhilpaekevtekwgkplvidklkemakveglwnlflpavsg
lshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwlepllqgnitsc
fcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivlgrtqntslsr
hkqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnlilge

SCOPe Domain Coordinates for d2wbia1:

Click to download the PDB-style file with coordinates for d2wbia1.
(The format of our PDB-style files is described here.)

Timeline for d2wbia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wbia2