Lineage for d2wb5b3 (2wb5 B:496-624)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286610Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 1286611Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) (S)
  5. 1286612Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 1286630Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)
  7. 1286631Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
    Uniprot Q8XL08 496-624
  8. 1286645Domain d2wb5b3: 2wb5 B:496-624 [206754]
    Other proteins in same PDB: d2wb5a1, d2wb5a2, d2wb5b1, d2wb5b2
    automated match to d2j62a1
    complexed with cl, na, vgb

Details for d2wb5b3

PDB Entry: 2wb5 (more details), 2.31 Å

PDB Description: glcnacstatins are nanomolar inhibitors of human o-glcnacase inducing cellular hyper-o-glcnacylation
PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2wb5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb5b3 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d2wb5b3:

Click to download the PDB-style file with coordinates for d2wb5b3.
(The format of our PDB-style files is described here.)

Timeline for d2wb5b3: