SCOPe 2.07: Domain d2wb5b1: 2wb5 B:40-178

Lineage for d2wb5b1 (2wb5 B:40-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Hyaluronidase N-terminal domain [143619] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
   Uniprot Q8XL08 41-178

8. Domain d2wb5b1: 2wb5 B:40-178 [206752]
   Other proteins in same PDB: d2wb5a2, d2wb5a3, d2wb5b2, d2wb5b3
   automated match to d2j62a3
   complexed with cl, na, vgb

Details for d2wb5b1

PDB Entry: 2wb5, 2.31 Å

PDB Description: glcnacstatins are nanomolar inhibitors of human o-glcnacase inducing cellular hyper-o-glcnacylation

PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2wb5b1:

Sequence; same for both SEQRES and ATOM records:

>d2wb5b1 d.92.2.3 (B:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

Timeline for d2wb5b1:

• d2wb5b1 first appeared in SCOPe 2.03
  
• d2wb5b1 appears in SCOPe 2.06
  
• d2wb5b1 appears in the current release, SCOPe 2.08