![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
![]() | Protein Hyaluronidase N-terminal domain [143619] (1 species) |
![]() | Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries) Uniprot Q8XL08 41-178 |
![]() | Domain d2wb5a1: 2wb5 A:40-178 [206749] Other proteins in same PDB: d2wb5a2, d2wb5a3, d2wb5b2, d2wb5b3 automated match to d2j62a3 complexed with cl, na, vgb |
PDB Entry: 2wb5 (more details), 2.31 Å
SCOPe Domain Sequences for d2wb5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb5a1 d.92.2.3 (A:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]} qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf kqlvkesnipevnitdypt
Timeline for d2wb5a1: