Lineage for d2wa5a1 (2wa5 A:0-124)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1735075Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1735076Protein automated matches [226856] (2 species)
    not a true protein
  7. 1735077Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)
  8. 1735088Domain d2wa5a1: 2wa5 A:0-124 [206735]
    automated match to d1sh5a1
    complexed with co3, so4

Details for d2wa5a1

PDB Entry: 2wa5 (more details), 1.9 Å

PDB Description: crystal structure of human filamin b actin binding domain at 1.9 angstroms resolution
PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2wa5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wa5a1 a.40.1.0 (A:0-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mapvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsq
krmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlil
hysis

SCOPe Domain Coordinates for d2wa5a1:

Click to download the PDB-style file with coordinates for d2wa5a1.
(The format of our PDB-style files is described here.)

Timeline for d2wa5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wa5a2