Class a: All alpha proteins [46456] (286 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries) |
Domain d2wa5a1: 2wa5 A:0-124 [206735] automated match to d1sh5a1 complexed with co3, so4 |
PDB Entry: 2wa5 (more details), 1.9 Å
SCOPe Domain Sequences for d2wa5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wa5a1 a.40.1.0 (A:0-124) automated matches {Human (Homo sapiens) [TaxId: 9606]} mapvtekdlaedapwkkiqqntftrwcnehlkcvnkrignlqtdlsdglrliallevlsq krmyrkyhqrptfrqmqlenvsvalefldresiklvsidskaivdgnlklilglvwtlil hysis
Timeline for d2wa5a1: