Lineage for d1duzd1 (1duz D:182-275)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158828Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)
  8. 158834Domain d1duzd1: 1duz D:182-275 [20672]
    Other proteins in same PDB: d1duza2, d1duzd2

Details for d1duzd1

PDB Entry: 1duz (more details), 1.8 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) in complex with a nonameric peptide from htlv-1 tax protein
PDB Compounds: (D:)

SCOP Domain Sequences for d1duzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duzd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1duzd1:

Click to download the PDB-style file with coordinates for d1duzd1.
(The format of our PDB-style files is described here.)

Timeline for d1duzd1: