SCOPe 2.03: Domain d2w9dl2: 2w9d L:107-211

Lineage for d2w9dl2 (2w9d L:107-211)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d2w9dl2: 2w9d L:107-211 [206719]
   Other proteins in same PDB: d2w9dl1
   automated match to d2fd6l2
   complexed with ca

Details for d2w9dl2

PDB Entry: 2w9d, 1.57 Å

PDB Description: structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.

PDB Compounds: (L:) icsm 18-anti-prp therapeutic fab light chain

SCOPe Domain Sequences for d2w9dl2:

Sequence; same for both SEQRES and ATOM records:

>d2w9dl2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2w9dl2:

• d2w9dl2 is new in SCOPe 2.03-stable
  
• d2w9dl2 appears in SCOPe 2.04
  
• d2w9dl2 appears in the current release, SCOPe 2.08