Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [225639] (2 PDB entries) |
Domain d2w90b1: 2w90 B:-1-175 [206716] Other proteins in same PDB: d2w90a2, d2w90b2 automated match to d1pgja2 complexed with 6pg, so4, trs |
PDB Entry: 2w90 (more details), 2.2 Å
SCOPe Domain Sequences for d2w90b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w90b1 c.2.1.0 (B:-1-175) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} ghmakhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysie efvnalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelael gihfigtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpd
Timeline for d2w90b1: