SCOPe 2.06: Domain d2w83e_: 2w83 E:

Lineage for d2w83e_ (2w83 E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d2w83e_: 2w83 E: [206708]
   automated match to d1upte_
   complexed with dio, gol, gtp, mg

Details for d2w83e_

PDB Entry: 2w83, 1.93 Å

PDB Description: crystal structure of the arf6 gtpase in complex with a specific effector, jip4

PDB Compounds: (E:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2w83e_:

Sequence; same for both SEQRES and ATOM records:

>d2w83e_ c.37.1.8 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldki
rplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdam
kpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsn

Timeline for d2w83e_:

• d2w83e_ first appeared in SCOPe 2.03
  
• d2w83e_ appears in SCOPe 2.05
  
• d2w83e_ appears in SCOPe 2.07
  
• d2w83e_ appears in the current release, SCOPe 2.08